PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_10347
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family MIKC_MADS
Protein Properties Length: 222aa    MW: 25548 Da    PI: 8.2294
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_10347genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.39.5e-291059251
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                rien + rqvtfskRrng+lKKA+ELSvLCdae+ +iifss+gklye+ss
  PEQU_10347 10 RIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEIGLIIFSSSGKLYEFSS 59
                8***********************************************96 PP

2K-box74.62.8e-2578171598
       K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                 ++++ +e++ + ++++++ + ++ie L  ++R+l+Ge+Les+s++eL++Le+qLe++l++++ +Kn++l+eqi +l+++e+elqee+  L+k+ 
  PEQU_10347  78 ENSRSTEQNIQPSKKDAEDMARKIELLNVSKRKLMGESLESCSVEELHELESQLEQGLTRVKRRKNHVLKEQITQLKERERELQEEHDLLQKQA 171
                 45668999********************************************************************************999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.721161IPR002100Transcription factor, MADS-box
SMARTSM004323.9E-40160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002652.92E-42372No hitNo description
PRINTSPR004042.5E-30323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.79E-32374IPR002100Transcription factor, MADS-box
PfamPF003193.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.9E-2384170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.94787177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MVRGKTELRR IENPTSRQVT FSKRRNGLLK KAFELSVLCD AEIGLIIFSS SGKLYEFSSS  60
SMSNTIERYK KHVKDVIENS RSTEQNIQPS KKDAEDMARK IELLNVSKRK LMGESLESCS  120
VEELHELESQ LEQGLTRVKR RKNHVLKEQI TQLKEREREL QEEHDLLQKQ ADFLASSLRK  180
PEVAVEALQE VVPEGDNQHK DVETELYIGW PAGGSTQQLL KR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A1e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D1e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3kov_A1e-19372271Myocyte-specific enhancer factor 2A
3kov_B1e-19372271Myocyte-specific enhancer factor 2A
3kov_I1e-19372271Myocyte-specific enhancer factor 2A
3kov_J1e-19372271Myocyte-specific enhancer factor 2A
3p57_A1e-19372271Myocyte-specific enhancer factor 2A
3p57_B1e-19372271Myocyte-specific enhancer factor 2A
3p57_C1e-19372271Myocyte-specific enhancer factor 2A
3p57_D1e-19372271Myocyte-specific enhancer factor 2A
3p57_I1e-19372271Myocyte-specific enhancer factor 2A
3p57_J1e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010919081.16e-84PREDICTED: MADS-box transcription factor 50-like isoform X2
SwissprotQ9XJ602e-68MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLX2F4421e-104X2F442_9ASPA; MADS-box protein 2
STRINGGSMUA_Achr5P10250_0019e-75(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.12e-55AGAMOUS-like 20